M.Sc. (1987) University of Amsterdam (UVA)
Ph.D. (1992) Free University Amsterdam (VUA)
Research Associate Professor (2003-) University of New Mexico (UNM)
PI on research project (2003-2009)
National Institutes of Health
(NIH), NIAID RO1 AI52363,
Subject: Anti-pathogen-responses in Biomphalaria glabrata
CETI, Department of Biology MSC03 2020,
228 Castetter Hall
University of New Mexico, Albuquerque, 87131 NM USA
Tel (505) 277 2743 (o); 3134 (l), Fax (505) 277 0304,
coenadem@unm.edu
Member of the
Biomphalaria glabrata genome initiative
Member of the Center for Evolutionary
and Theoretical Immunology (CETI)
Current focus
Molecular characterization of gene
expression profiles during anti-pathogen responses of Biomphalaria glabrata;
Function, diversity, expression of fibrinogen-related proteins (FREPs) produced
by Biomphalaria glabrata and other molluscs.
TECHNIQUES USED
Parasitology: in vitro
culture of Trichomonas vaginalis (flagellate protozoan), maintenance
of life cycles and in vitro culture of Acantocheilonema (previously Dipetalonema)
viteae (filarial nematode), Trichobilharzia ocellata, Echinostoma
paraensei, and Schistosoma mansoni (digenetic trematodes), maintenance
of several snail species. Field collection of aquatic snails, testing for digenean
infection.
Histology: cryostat and
parrafin sections
Cell biology: monolayers,
phagocytosis, cytochemical assays for lysozymal enzymes, antibody- and lectin-recognized
surface epitopes, intravacuole pH and ROIs, spectrophotometrical assays for
ROIs, luminol dependent chemiluminescence (LDCL), inhibition of NADPH-oxidase,
development of anti-clumping buffer, density gradient cell separations, cell
free ROI cytotoxicity assays, time-lapse video microscopy, confocal microscopy,
hemocyte rounding assays, hemocyte bactericidal assay.
Serology: immuno-absorption,
immunizations, for antisera and monoclonal antibody production, ELISA, IFAT,
western blotting.
Protein biochemistry: size exclusion chromatography, SDS- and native PAGE, blotting,
preparation of samples for amino acid sequencing, protein biotinylation,
, proteomics (sample preparation for MS/tandem MS and computational analysis).
Molecular biology: (CTAB) genomic DNA extractions, high molecular weight DNA extraction,
alkaline lysis (and kit) plasmid DNA extractions, restriction digests,
(m)RNA extractions, DNA and RNA gel electrophoresis, isotope/biotin labeling
of DNA and anti-sense RNA probes, Southern blotting, northern blotting, in-situ
hybridization, PCR primer design, PCR, LD-PCR, RT-PCR, qPCR, (TA-) cloning,
construction of genomic and cDNA libraries, cycle sequencing, EST-techniques
(EST; ORESTES; SSH-ESTs), marathon and gene walker protocols, EZ::TN mediated
sequencing of constructs, BAC DNA extraction, subcloning and sequencing, oligo
micro array design and probing.
Software: (pc-based) dnasis,
chromas, blast, entrez, expasy motifs, image analysis, sequencher, genedoc,
bioedit.
BIRTH
27th July 1963, San Jose, California, USA
USA and Dutch (dual) nationalities
EDUCATION
1984 BS Medical Biology
University of Amsterdam (UVA), The Netherlands
1987 MS Medical Biology, Cum Laude
University of Amsterdam (UVA), The Netherlands
Medical Parasitology: Demonstration of circulating antigens
in filariasis.
With two subsidiary subjects
a) Molecular Cell Pathology: The cloning of single
copy DNA from human chromosome 14.
b) Teaching Degree, general biology.
1992 PhD
Free University (VU) Amsterdam, The Netherlands
Dept. of Medical Microbiology and Parasitology,
Faculty of Medicine, Feb 1988 - July 1992
Dissertation: Haemocyte-mediated cytotoxicity in the pond snail
Lymnaea stagnalis,
intermediate host of Trichobilharzia ocellata
POSITIONS
Post-doc (1993-1999)
Department of Biology, University of New Mexico (UNM)
Albuquerque, New Mexico, USA
1993 Senior Research Associate I
1997 Research Assistant Professor
Subject: Comparative immunobiology of invertebrate host/parasite
associations
Post-doc mentor Dr ES Loker
Research Assistant Professor (1999-2003)
PI on NSF grant,
Subject: Function and diversity of molluscan FREPs
Department of Biology, University of New Mexico (UNM)
Albuquerque, New Mexico, USA
Research Associate Professor, (2003-present)
PI on NIH grant,
Subject: Anti-pathogen responses in Biomphalaria glabrata
Department of Biology, University of New Mexico (UNM)
Albuquerque, New Mexico, USA
GRANTS
Dutch Foundation for Scientific Research (NWO)
Three week working visit to URPIGM/IFREMER,
La Tremblade, France. Subject: Comparative gastropod/bivalve
immunobiology Feb-Mar 1991
European Community (EC)Human Resources Program
personal application for a 2 year post-doc position
with IFREMER, Montpellier, France. Subject: Bactericidal activity
in the bivalve Mytilus edulis
Post-doc mentor Dr P Roch Grant was declined as it was
awarded only after CM Adema had accepted
a post-doc position at UNM, Albuquerque, NM, USA 1993
National Science Foundation (NSF) MCB 9974930,
Principal investigator (PI)
Biology UNM, Albuquerque, NM, USA. Subject: Function and diversity
of molluscan FREPs
1 August 1999-2002, Budget $320,108.--
National Science Foundation (NSF) supplement
for MCB 9974930, Research experience for undergraduate (REU),
10 weeks student stipend, summer 2000, Budget $4,063.--
National Institutes of Health (NIH), NIAID RO1 AI052363,
Principal investigator (PI)
Biology UNM, Albuquerque, NM, USA. Subject: Anti-pathogen-responses
in Biomphalaria glabrata
April 2003-2008, total budget $1,299,700.--
University of Wyoming/National Park Service
(UW/NPS), Co-principal investigator (co-PI) with Dr RS Seville (UW Casper),
UW/NPS Research Station, Jackson WY, USA. Subject: Parasite infection status
of Potamopyrgus antipodarum
July-August 2005, total Budget $3,000.--
National Institutes of Health (NIH), NIAID RO1
AI024340, Co-Principal investigator (PI: Dr ES Loker)
Biology UNM, Albuquerque, NM,
USA. Subject: Biology of trematode-snail associations
March 2006-2011, total budget $1,687,500.--
TEACHING
Teacher of classes and labs
Medical Parasitology IWO/AMC, University of Amsterdam,
Medical Microbiology and Parasitology, MMP/GNK
Free University (VU), Amsterdam, The Netherlands
a) Joint course Parasitology for medical biology students 1988
b) Several courses Parasitology for medical students 1988-1993
Supervision of two undergraduate student research
projects
Medical Microbiology and Parasitology,
Faculty of Medicine, Free University (VU) Amsterdam, the Netherlands
Sponsors: Faculty of Medicine, Free University (VU) 1991 and
EEC “ERASMUS network for Fish Pathology” 1991
Teaching of lectures to biology students
undergraduate and graduate levels, several hours
General Biology, Parasitology, Vector Biology, Invertebrate
Zoology, Immunology
University of New Mexico (UNM), NM USA, 1993-present
Courses taught at the University of New Mexico (UNM)
- Introductory Parasitology, 1997
- Comparative Immunology, 1997
- Molecular Cell Biology 2 (426/526) 2002
- Laboratory Methods in Molecular Biology (446/546) Fall 2006
- Parasitology(482L/582L) Spring 2007
- Molecular and Cell Biology (201) Fall 2007
- Molecular and Cell Biology (201) Spring 2008
- Laboratory Methods in Molecular Biology (446/546) Fall 2008
- Parasitology(482L/582L) Spring 2009
Supervision of research experience for undergraduates
(REU) students,
Biology, University of New Mexico (UNM), NM USA 1993-present
Sponsors: Howard Hughes Foundation and
Minority Biomedical Research Support (MBRS), 1993-1998, 2002-2004
National Science Foundation (NSF), 2000-2001
Minority Access to Research careers (MARC) 2004-2005
Initiative for Minority Student Development (IMSD) 2005-2006
Problems class 499, Parasite infections of the Red Shiner (Cyprinella lutrensis)
in the Rio Grande, Fall 2007
Supervision of undergraduate and graduate student
research, Biology,
University of New Mexico (UNM), NM USA, 1994-present
Committee member of PhD. student, Biology UNM, 1999-2001
Committee member of Ms student, Biology UNM,
2003
Committee member of Ms
student, Computer Sciences UNM, 2005
Committee member of PhD
student, Computer Sciences UNM, 2006
External Examiner of PhD
thesis, Macquarie University, Sydney, NSW Australia, 2007
AWARDS AND HONORS
Dutch Society for Parasitology (NVP)
~US$ 250, awarded twice, towards attendance and oral presentation
a) Joint Spring Meeting British, Belgian and Dutch Societies
for Parasitology,
Southampton UK 1989
b) Spring Meeting British Society for Parasitology, Symposium
Molluscs in Parasite
Life Cycles, Liverpool UK 1991
International Society for Developmental and Comparative
Immunology (ISDCI)
US$ 300 towards attendence and presentation,
Vth ISDCI conference Portland OR, USA (PhD-student category)
July 1991
JE Jurriaanse Foundation, Rotterdam, The Netherlands
~US$ 1000 towards completion of PhD dissertation June 1992
Keystone Symposia, US$ 500 for scientific merit
of poster (post-doc category)
Molecular Helminthology conference, Santa Fe NM, USA February
1996
10th Symposium on Schistosomiasis, Invited speaker, Belho Horizonte, Brazil, Sep 2005
President's symposium on Immunity
in invertebrate hosts of parasites, American Society of Parasitologists (ASP),
Invited speaker, Joint Meeting at ICOPA, Glasgow, Scotland, Aug 2006
SCIENTIFIC SOCIETIES
American Society of Parasitologists (ASP)
American Society for Tropical Medicine and Hygiene (ASTMH)
International Society for Developmental and Comparative Immunology
(ISDCI)
Southwestern
Association of Parasitologists (SWAP)
1) Adema CM, van Deutekom-Mulder EC, van der Knaap WPW, Meuleman EA, Sminia T (1991) Generation of oxygen radicals in hemocytes of the snail Lymnaea stagnalis in relation to the rate of phagocytosis. Developmental and Comparative Immunology 15:17-26.
2)Adema CM, van der Knaap WPW, Sminia T (1991) Molluscan hemocyte-mediated cytotoxicity: the role of reactive oxygen intermediates. Reviews in Aquatic Sciences 4:201-223.
3)Adema CM, Harris RA, van Deutekom-Mulder EC (1992)A comparative-study of hemocytes from 6 different snails: morphology and functional-aspects. Journal of Invertebrate Pathology 59:24-32.
4) Harris RA, Adema CM, van Deutekom-Mulder EC (1992) A comparative-study of hemocytes from 6 different snails : surface staining with lectins and monoclonal-antibodies. Comparative Haematology International 2:30-34.
5) Mohandas A, Adema CM, van der Knaap WPW, Sminia T (1992) The effect of hemolymph extraction on distribution of lysosomal-enzymes in Lymnaea stagnalis hemocytes: a cytochemical study. Comparative Haematology International 2:61-67.
6) van der Knaap WPW, Adema CM, Sminia T (1993) Invertebrate blood-cells : morphological and functional-aspects of the hemocytes in the pond snail Lymnaea stagnalis. Comparative Haematology International 3:20-26.
7) Fryer SE, Adema CM (1993) Manipulation of Biomphalaria glabrata (Say) (gastropoda, planorbidae) hemocytes in-vitro. Journal of Molluscan Studies 59:371-379.
8) Adema CM, van Deutekom-Mulder EC, van der Knaap WPW, Sminia T (1993) NADPH-oxidase activity : the probable source of reactive oxygen intermediate generation in hemocytes of the gastropod Lymnaea stagnalis. Journal of Leukocyte Biology 54:379-383.
9)Adema CM, Mohandas A, van der Knaap WPW, Sminia T (1994) Separation of Lymnaea stagnalis hemocytes by density gradient centrifugation. Developmental and Comparative Immunology 18:25-31.
10) Adema CM, van Deutekom-Mulder EC, van der Knaap WPW, Sminia T (1994) Schistosomicidal activities of Lymnaea stagnalis hemocytes: the role of oxygen radicals. Parasitology 109:479-485.
11) Nunez PE, Adema CM, de Jong-Brink M (1994) Modulation of the bacterial clearance activity of hemocytes from the fresh-water mollusk, Lymnaea stagnalis, by the avian schistosome, Trichobilharzia ocellata. Parasitology 109:299-310.
12) Adema CM, Arguello DF, Stricker SA, Loker ES (1994) A time-lapse study of interactions between Echinostoma paraensei intramolluscan larval stages and adherent hemocytes from Biomphalaria glabrata and Helix aspersa. Journal of Parasitology 80:719-727
13) Loker ES, Adema CM (1995) Schistosomes, echinostomes and snails: comparative immunobiology. Parasitology Today, 11:120-124
14) Hanelt B, van Schyndel D, Adema CM, Lewis LA, Loker ES (1996) The phylogenetic position of Rhopalura ophiocomae (orthonectida) based on 18S ribosomal DNA-sequence analysis. Molecular Biology and Evolution, 13:1187-1191 PDF
15) Hanelt B, Adema CM, Mansour MH, Loker ES (1997) Detection of Schistosoma mansoni in Biomphalaria using nested PCR. Journal of Parasitology 83:387-394
16) Adema CM, Loker ES (1997) Specificity and immunobiology of larval digenean-snail associations. In Advances in Trematode Biology, Eds Fried B, Graczyk TK, CRC Press, Boca Raton Florida, pp 230-263
17) Adema CM, Hertel LA, Loker ES (1997) Infection with Echinostoma paraensei (Digenea) induces parasite-reactive polypeptides in the hemolymph of the gastropod host Biomphalaria glabrata. In Parasite Effects on Host Physiology and Behavior, Ed Beckage N, Chapman Press New York, pp 77-99
18) Adema CM, Hertel LA, Miller RD, Loker ES (1997) A family of fibrinogen-related proteins that precipitates parasite-derived molecules is produced by an invertebrate after infection. Proceedings of the National Academy of Sciences USA 94: 8691-8696
19) Adema CM, Hertel LA, Loker ES (1999) Evidence from two planorbid snails of a complex and dedicated response to digenean (echinostome) infection. Parasitology 119:395-404.
20) Adema CM, Léonard PM, DeJong RJ, Day H, Edwards D, Burgett G, Hertel LA, Loker ES (2000) Analysis of messages expressed by Echinostoma paraensei miracidia and sporocysts, obtained by random EST sequencing. Journal of Parasitology 86:60-65.
21) Adema CM, Sapp KK, Hertel LA, Loker ES (2000) Immunobiology of the relationship of echinostomes with invertebrate hosts. In Echinostomes as Experimental Models for Biological Research, Eds Fried B, Graczyk TK, Kluwer Academic Publishers, Dortdrecht, The Netherlands, pp 149-174.
22) Léonard PM, Adema CM, Zhang S-M, Loker ES (2001) Structure of two FREP genes that encode IgSF and fibrinogen domains, with comments on diversity of the FREP gene family in the snail Biomphalaria glabrata. Gene 269:155-165.
23) DeJong RJ, Morgan JAT, Paraense WL, Pointier J-P, Amarista M, Ayeh-Kumi PFK, Babiker A, Barbosa CS, Brémond P, Canese AP, de Souza CP, Dominguez C, File S, Gutierrez A, Incani RN, Kawano T, Kazibwe F, Kpikpi J, Lwambo NJS, Mimpfoundi R, Njiokou F, Poda JN, Sene M, Velásquez LE, Yong M, Adema CM, Hofkin BV, Mkoji GM and Loker ES (2001) Evolutionary relationships and biogeography of Biomphalaria (Gastropoda: Planorbidae) with implications regarding its role as host of the human bloodfluke, Schistosoma mansoni. Molecular Biology and Evolution 18:2225-2239.
24) Zhang S-M, Léonard PM, Adema CM, Loker ES (2001) Parasite responsive IgSF members in the snail Biomphalaria glabrata: characterization of novel genes with tandemly arranged IgSF domains and a fibrinogen domain. Immunogenetics. 53:684-694.
25) Adema CM (2002) Comparative study of cytoplasmic actin DNA from six species of Planorbidae (Gastropoda: Basommatophora). Journal of Molluscan Studies 68:17-23.
26) Horak P, Kolarova L, Adema CM (2002) Biology of the schistosome genus Trichobilharzia. Advances in Parasitology 52:155-233.
27) Loker ES, Adema CM, Zhang S-M, Kepler TB (2004) Invertebrate immune systems – not homogeneous, not simple, not well understood. Immunological Reviews 198:10-24.
28) Zhang S-M, Adema CM, Kepler TB, Loker ES (2004) Diversification of Ig superfamily genes in an invertebrate. Science 305:251-254.
29) DeJong RJ, Emery A, Adema CM (2004) The mitochondrial genome of Biomphalaria glabrata (Gastropoda: Bassomatophora), intermediate host of Schistosoma mansoni. Journal of Parasitology 90:991-996.
30) Nowak S, Woodards A, Jung Y, Adema CM, Loker (2004) Expressed sequence tags (ESTs) differentially expressed during the internal defense response to Schistosoma mansoni of a resistant strain of Biomphalaria glabrata. Journal of Parasitology 90:1034-1041.
31) Hertel LA, Adema CM, Loker ES (2005) Differential expression of FREP genes in two strains of Biomphalaria glabrata following exposure to the digenetic trematodes Schistosoma mansoni and Echinostoma paraensei. Developmental and Comparative Immunology 29:295-303.
32) Qiu S, Adema CM, Lane T (2005) A computational study of off-target effects of RNA-interference. Nucleic Acids Research 33:1834-1847.
33) Jung Y, Nowak S, Hertel LA, Zhang S-M, Loker ES, Adema CM (2005) Manganese superoxide dismutase from Biomphalaria glabrata. Journal of Invertebrate Pathology 90:59-63.
34) Lieb B, Dimitrova K, Kang HS, Braun S, Gebauer W, Martin A, Hanelt B, Saenz SA, Adema CM, Markl J (2006) Red blood with blue-blood ancestry: intriguing structure of a snail hemoglobin. Proceedings of the National Academy of Sciences USA 103:12011-12016. (Epub 2006 Jul 28).
35) Adema CM, Luo M-Z, Hanelt B, Hertel LA, Marshall JJ, Zhang S-M, DeJong RJ, Kim H-R, Kudrna D, Wing RA, Soderlund C, Knight M, Lewis FA, Caldeira RL, Jannotti-Passos LK, Carvalho OS, Loker ES (2006) A BAC library for Biomphalaria glabrata, intermediate snail host of Schistosoma mansoni. Memorias do Instituto Oswaldo Cruz 101:167-177.
36) Hanelt B, Lun C-M, Adema, CM (2008) Comparative ORESTES-sampling of transcriptomes of immune-challenged Biomphalaria glabrata snails. Journal of Invertebrate Pathology, 99, 192-203. PMID 18590737.
37) Coustau C, Gourbal B, Mitta G, Adema CM. (2008). Echinostomes and snails: exploring complex interactions. Chapter 2 in: The Biology of Echinostomes (Fried B and Toledo R, eds.), New York: Springer. 35-60.
38) Stout BA, Adema CM, Zhang S-M, Loker ES (2009) The biology of FREPs: diversified lectins with fibrinogen-related domains from the freshwater snail Biomphalaria glabrata. In Animal Lectins: A Functional View. Eds: G. Vasta & H. Ahmed. CRC Press Taylor & Francis. pp 475-491.
39) Adema CM, Lun C-M , Hanelt B, Seville, RS (2009) Digeneann trematode infections of native fresh water snails and invasive Potamopyrgus antipodarum in the Grand Teton National Park/John D Rockefeller Memorial Parkway Area. Journal of Parasitology, in press PMID 18576875.
40)Zhang S-M, Nian H, Wang B, Loker ES, Adema CM (2009) Schistosomin from the snail Biomphalaria glabrata: Expression studies suggest no involvement in trematode-mediated castration. Molecular and Biochemical Parasitology. 165, 79-86.
Miscellaneous
1) Adema CM, Knight M, Lewis FA, Loker ES (2002) Request for making
a BAC library from Biomphalaria glabrata (gastropod mollusc), the prominent
snail species contributing to transmission of human schistosomiasis. In July
2002, review of this white paper by the Genome Resources and Sequencing Priorities
Panel (GRASPP) of the NHGRI (National Human Genome Research Institute) BAC Resource
Steering Panel yielded a "high priority" recommendation. In cooperation with
the NIH BAC resources program, a BAC library was produced that is now available
to the research community.
2) Knight M, Adema CM, Raghavan N, Loker ES, Lewis FA, Tettelin H (2003) Obtaining the genome sequence of the mollusc Biomphalaria glabrata: a major intermediate host for the parasite causing human schistosomiasis. In July 2004, review of this white paper resulted in the addition of B. glabrata to the genome sequencing pipeline of NHGRI ("high priority" recommendation)
About
this background
The background used depicts partial
BLAST results yielded by comparing BgMFREP1 to the NCBI nr-databases using BLASTX
(1997). Insights into FREP genes and fascination with sequence similarities
have developed considerably since.
..............................................Sequences producing significant alignments: (bits) Value
gi|2317880
(U82471) BgMFREP1 [Biomphalaria glabrata] ............. 254 1e-67
gi|2317878
(U82473) BalFREP1 [Biomphalaria alexandrina] ...........247 2e-65
gi|2317890
(U82475) HtrFREP1 [Helisoma trivolvis] .................198 1e-50
gi|2317872
(U82480) fibrinogen-related protein 3 [Biomphalaria ... 194 1e-49
gi|2317870
(U82479) fibrinogen-related protein 2 [Biomphalaria ... 194 2e-49
gi|2317884
(U82476) BgSFREP1 [Biomphalaria glabrata] ..............192 5e-49
gi|2317868
(U82478) fibrinogen-related protein 4 [Biomphalaria ... 187 2e-47
gi|2317888
(U82474) BtrFREP1 [Bulinus truncatus] ..................175 1e-43
gi|2317882
(U82472) BgRFREP1 [Biomphalaria glabrata] ..............155 1e-37
gi|2317886
(U82477) BgBFREP1 [Biomphalaria glabrata] ..............151 1e-36
gnl|PID|d1008948
(D49353) serum lectin P35 [Homo sapiens] >gi|1... 135 8e-32
BgMFREP1
[Biomphalaria glabrata] Length = 118 Score = 254 bits (643), Expect =
1e-67
Identities = 118/118 (100%), Positives = 118/118 (100%)
..Query: 1 DTTTDGGGWIIFQRRINGKVDFYRGWKEYRDGFGDYNIGEFYLGNENIFMLTSGRQYELR
180
......DTTTDGGGWIIFQRRINGKVDFYRGWKEYRDGFGDYNIGEFYLGNENIFMLTSGRQYELR
Sbjct:
1 DTTTDGGGWIIFQRRINGKVDFYRGWKEYRDGFGDYNIGEFYLGNENIFMLTSGRQYELR 60
..Query: 181 IDMEFKTKKYFAKYSRFKVLSEANNYQLKIESFSGNAGDSLTYHNDQFFSTFDKDNDD
354
.........IDMEFKTKKYFAKYSRFKVLSEANNYQLKIESFSGNAGDSLTYHNDQFFSTFDKDNDD
..Sbjct: 61 .IDMEFKTKKYFAKYSRFKVLSEANNYQLKIESFSGNAGDSLTYHNDQFFSTFDKDNDD
118
BalFREP1
[Biomphalaria alexandrina] Length = 118 Score = 247 bits (624), Expect
=
2e-65
Identities = 114/118 (96%), Positives = 115/118 (96%)
..Query: 1 DTTTDGGGWIIFQRRINGKVDFYRGWKEYRDGFGDYNIGEFYLGNENIFMLTSGRQYELR
180
.......DTTTDGGGWIIFQRRINGKVDFYRGW+EYRDGFGDYNIGEFYLGNENIF LTSGRQYELR
.Sbjct: 1 DTTTDGGGWIIFQRRINGKVDFYRGWQEYRDGFGDYNIGEFYLGNENIFKLTSGRQYELR
60
..Query: 181 IDMEFKTKKYFAKYSRFKVLSEANNYQLKIESFSGNAGDSLTYHNDQFFSTFDKDNDD
354
.........IDMEFKTKKYFAKYSRFKVLSEANNYQL IE FSGNAGDSLTYHNDQFFSTFDKDNDD
..Sbjct: 61 .IDMEFKTKKYFAKYSRFKVLSEANNYQLNIEKFSGNAGDSLTYHNDQFFSTFDKDNDD
118
HtrFREP1
[Helisoma trivolvis] Length = 118 Score = 198 bits (497), Expect = 1e-50
Identities
= 89/118 (75%), Positives = 101/118 (85%)
..Query: 1 DTTTDGGGWIIFQRRINGKVDFYRGWKEYRDGFGDYNIGEFYLGNENIFMLTSGRQYELR
180
.......DTTTDGGGWIIFQRRINGKV+FYRGWKEYRDGFG+Y IGEFYLGN NIFMLTS R+YELR
.Sbjct: 1 DTTTDGGGWIIFQRRINGKVNFYRGWKEYRDGFGNYTIGEFYLGNNNIFMLTSRRKYELR
60
..Query: 181 IDMEFKTKKYFAKYSRFKVLSEANNYQLKIESFSGNAGDSLTYHNDQFFSTFDKDNDD
354
....ID EF ++KYFAKYS+F++ E YQL I+ FSGN GD+L N++ FSTFDKDNDD
..Sbjct: 61 .IDFEFNSRKYFAKYSKFELFGEGQYYQLHIDGFSGNVGDNLKIQNNKEFSTFDKDNDD
118
fibrinogen-related
protein 3 [Biomphalaria glabrata] Length = 387 Score = 194
bits
(489), Expect = 1e-49 Identities = 85/118 (72%), Positives = 102/118 (86%)
..Query: 1 ..DTTTDGGGWIIFQRRINGKVDFYRGWKEYRDGFGDYNIGEFYLGNENIFMLTSGRQYELR
180
.........DT TDGGGWIIFQRRING VDFYRGWKEYRDGFGDYNIGEFYLGNENI+MLTS .QY
LR
..Sbjct: 211 DTKTDGGGWIIFQRRINGNVDFYRGWKEYRDGFGDYNIGEFYLGNENIYMLTSTGQYNLR
270
Query:
181 IDMEFKTKKYFAKYSRFKVLSEANNYQLKIESFSGNAGDSLTYHNDQFFSTFDKDNDD 354
.......ID+++K K +FA+YS FK+LSE...Y+L I ++SGN+GD++ .HN+ FF+TFD+DND+
Sbjct:
271 IDLKYKNKAFFAQYSGFKILSEKEKYKLNIGAYSGNSGDNFSSHNNAFFTTFDRDNDE 328
fibrinogen-related
protein 2 [Biomphalaria glabrata] Length = 372 Score = 194
bits
(488), Expect = 2e-49 Identities = 88/117 (75%), Positives = 103/117 (87%),
Gaps
= 1/117 (0%)
..Query: 1 ..DTTTDGGGWIIFQRRINGKVDFYRGWKEYRDGFGDYNIGEFYLGNENIFMLTSGRQYELR
180
.........DT TDGGGWIIFQRRING VDFYRGWKEYRDGFGDY+IGEFYLGNENIF LTS ++Y+LR
..Sbjct: 196 DTKTDGGGWIIFQRRINGYVDFYRGWKEYRDGFGDYDIGEFYLGNENIFKLTSSKKYDLR
255
Query:
181 IDMEFKTKKYFAKYSRFKVLSEANNYQLKIESFSGNAGDSLT-YHNDQFFSTFDKDND 351
..
....ID+EF ..KYFA Y+RF++L E + Y+L+I. +SGNAGD+LT .HND+FFST+DKDND
Sbjct:
256 IDLEFNNTKYFAFYTRFEILGEQDYYKLQIGGYSGNAGDALTNIHNDKFFSTYDKDND 313